Cat. No.: IBDP-531903
Size:
Online InquiryTarget Information
Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
Function | Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. |
Product Details
Product Type | Peptide |
Cas | 252642-12-9 |
Molecular Weight | 4195.83 kDa |
Purity | 0.9811 |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |