Cat. No.: IBDP-531906
Size:
Online InquiryTarget Information
| Sequence | LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF |
| Function | Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4314.91 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |