Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Apelin-36 TFA

Cat. No.: IBDP-531904

Size:

Target Information

Sequence LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Function Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ.

Product Details

Product Type Peptide
Molecular Weight 4309.85 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.