Cat. No.: IBDP-531904
Size:
Online InquiryTarget Information
| Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Function | Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4309.85 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |