Cat. No.: IBDP-531937
Size:
Online InquiryTarget Information
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Function | Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al. |
Product Details
| Product Type | Peptide |
| Cas | 1444827-29-5 |
| Molecular Weight | 3385.90 kDa |
| Purity | 0.9878 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |