Cat. No.: IBDP-531952
Size:
Online InquiryTarget Information
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
| Function | Beinaglutide is a recombinant human GLP-1 (rhGLP-1) polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH). |
Product Details
| Product Type | Peptide |
| Cas | 123475-27-4 |
| Molecular Weight | 3298.61 kDa |
| Purity | 0.9947 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |