Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Brain Natriuretic Peptide (1-32), rat acetate

Cat. No.: IBDI-438270

Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Size (Solid):

Product Details

Target Angiotensin Receptor
Molecular Weight 3512.99
Appearance Solid
Synonyms BNP (1-32), rat acetate
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)
Sequence Shortening NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
Purity 99.02%

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.