Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Charybdotoxin TFA

Cat. No.: IBDP-532011

Size:

Target Information

Sequence {Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
Function Charybdotoxin TFA, a 37-amino acid peptide, is a K+ channel blocker.

Product Details

Product Type Peptide
Molecular Weight 4409.91 kDa
Purity 0.9833

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.