Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Defensin HNP-1 human

Cat. No.: IBDI-438239

Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities.

Size (Solid):

Product Details

Target Bacterial | PaRasite
Molecular Weight 3442.03
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys
Sequence Shortening ACYCRIPACIAGERRYGTCIYQGRLWAFCC

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.