Cat. No.: IBDP-532102
Size:
Online InquiryTarget Information
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Function | Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities. |
Product Details
| Product Type | Peptide |
| Cas | 99287-08-8 |
| Molecular Weight | 3442.03 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |