Cat. No.: IBDA-430027
Size:
Online InquiryTarget Information
| Target Name | ECaC/TRPV5 |
| Synonyms | TRPV5 | CAT2 | Calcium transport protein 2 | Calcium transporter 2 | ECAC1 | Epithelial calcium channel 1 | ECaC | OTRPC3 | Osm-9-like TRP channel 3 |
| Uniprot ID | Q9NQA5 |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-Terminus of human TRPV5 (580-610 aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid. |
Product Details
| Description | TRPV5 antibody is an unconjugated rabbit polyclonal antibody to TRPV5 (ECaC) (aa580-610) from human. |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Purity | Immunogen affinity purified |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
| Reactivity | Rat, Human |
| Specificity | Expressed at high levels in kidney, small intestine and pancreas, and at lower levels in testis, prostate, placenta, brain, colon and rectum. . |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-Terminus of human TRPV5 (580-610 aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid. |
| Application | WB |
Storage & Handling
| Shipping | Shipped on dry ice. |
| Storage | Short term: 4 °C. Long term: -20 °C |
| Storage Buffer | Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Sodium Azide. |
| Handling | Avoid freeze-thaw cycles. |