ECaC/TRPV5 Polyclonal Antibody

Target Information

Target Name	ECaC/TRPV5
Synonyms	TRPV5 | CAT2 | Calcium transport protein 2 | Calcium transporter 2 | ECAC1 | Epithelial calcium channel 1 | ECaC | OTRPC3 | Osm-9-like TRP channel 3
Uniprot ID	Q9NQA5
Immunogen	Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.

Product Details

Description	TRPV5 antibody is an unconjugated rabbit polyclonal antibody to TRPV5 (ECaC) from human.
Host Species	Rabbit
Clonality	Polyclonal
Purity	Immunoaffinity purified
Conjugation	Unconjugated
Modifications	Unmodified
Reactivity	Rat, Human
Immunogen	Amino acids DTHWRVAQERDELWRAQVVATTVMLERKLPR of human TRPV5 were used as the immunogen for the TRPV5 antibody.
Application	WB

Storage & Handling

Shipping	Shipped on dry ice.
Storage	Short term: 4 °C. Long term: -20 °C
Storage Buffer	Lyophilized from PBS, 2.5% BSA, 0.025% Sodium Azide.
Handling	Avoid freeze-thaw cycles.