Cat. No.: IBDP-532144
Size:
Online InquiryTarget Information
| Sequence | ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39) |
| Function | Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1. |
Product Details
| Product Type | Peptide |
| Cas | 154303-05-6 |
| Molecular Weight | 5417.00 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |