Cat. No.: IBDI-438369
Product Details
| Target | ERK |
| Molecular Weight | 3742.18 |
| Appearance | Solid |
| Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Sequence Shortening | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Purity | 99.07% |
Storage & Handling
| Shipping | Room temperature in continental US. May vary elsewhere. |
| Storage | Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month |
| Handling | Sealed storage, away from moisture and light, under nitrogen |
| Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |