Cat. No.: IBDP-532161
Size:
Online InquiryTarget Information
| Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Function | Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase. |
Product Details
| Product Type | Peptide |
| Cas | 133972-52-8 |
| Molecular Weight | 3628.16 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |