Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Endothelin-1 (1-31) TFA

Cat. No.: IBDP-532163

Size:

Target Information

Sequence CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11)
Function Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase.

Product Details

Product Type Peptide
Molecular Weight 3742.18 kDa
Purity 0.9907

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.