Cat. No.: IBDA-430728
Size:
Online InquiryTarget Information
| Target Name | EPCAM |
| Synonyms | EPCAM | 323/A3 | ACSTD1 | 17-1A | CD326 | EGP | EGP34 | Epithelial glycoprotein | GA733-2 | HNPCC8 | Ep-CAM | ESA | HEGP314 | KS 1/4 antigen | KS1/4 | KSA | M1S2 | MIC18 | MK-1 | MH99 | TROP1 | TACST-1 | TACSTD1 | CD326 antigen | CO-17A | DIAR5 | EGP-2 | EGP314 | EGP40 | Epithelial glycoprotein 314 | HEA125 | Ly74 | M4S1 |
| Uniprot ID | P16422 |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami. |
Product Details
| Description | EPCAM antibody is an unconjugated rabbit polyclonal antibody to human EPCAM. |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Purity | Immunogen affinity purified |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
| Reactivity | Human |
| Specificity | Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma. . |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami. |
| Application | ELISA, Flo, ICC, IHC, IHC-P, WB |
Storage & Handling
| Shipping | Shipped on dry ice. |
| Storage | Short term: 4 °C. Long term: -20 °C |
| Storage Buffer | Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg Sodium Azide. |
| Handling | Avoid freeze-thaw cycles. |