Cat. No.: IBDA-430691
Size:
Online InquiryTarget Information
| Target Name | EPCAM |
| Synonyms | EPCAM | 323/A3 | ACSTD1 | 17-1A | CD326 | EGP | EGP34 | Epithelial glycoprotein | GA733-2 | HNPCC8 | Ep-CAM | ESA | HEGP314 | KS 1/4 antigen | KS1/4 | KSA | M1S2 | MIC18 | MK-1 | MH99 | TROP1 | TACST-1 | TACSTD1 | CD326 antigen | CO-17A | DIAR5 | EGP-2 | EGP314 | EGP40 | Epithelial glycoprotein 314 | HEA125 | Ly74 | M4S1 |
| Uniprot ID | P16422 |
| Immunogen | Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein were used as the immunogen for the EpCAM antibody. |
Product Details
| Description | EPCAM antibody is an unconjugated rabbit polyclonal antibody to human EPCAM. |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Purity | Antigen Affinity purification |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
| Reactivity | Human |
| Immunogen | Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein were used as the immunogen for the EpCAM antibody. |
| Application | ELISA, IHC-P, WB |
Storage & Handling
| Shipping | Shipped on dry ice. |
| Storage | Short term: 4 °C. Long term: -20 °C |
| Storage Buffer | Lyophilized from PBS, 2.5% BSA, 0.025% Sodium Azide. |
| Handling | Avoid freeze-thaw cycles. |