Cat. No.: IBDP-532164
Size:
Online InquiryTarget Information
| Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42) |
| Function | Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer. |
Product Details
| Product Type | Peptide |
| Cas | 62253-63-8 |
| Molecular Weight | 6215.98 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |