GIP, human TFA

Cat. No.: IBDI-438426

GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

Product Details

Target	Insulin Receptor
Molecular Weight	5097.62
Appearance	Solid
Synonyms	Gastric Inhibitory Peptide (GIP)
Sequence	Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
Sequence Shortening	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Purity	99.88%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture and light, under nitrogen
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.