Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

GLP-2(1-33)(human)

Cat. No.: IBDI-435968

GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Size (Solid):

Product Details

Target GCGR
Molecular Weight 3766.19
Appearance Solid
Synonyms GLP-2 (human), Glucagon-like peptide 2
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence Shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Purity 99.18%

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture and light
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.