Cat. No.: IBDP-532228
Size:
Online InquiryTarget Information
| Sequence | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Function | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). |
Product Details
| Product Type | Peptide |
| Cas | 195262-56-7 |
| Molecular Weight | 3796.14 kDa |
| Purity | 0.9804 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |