Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Glucagon-Like Peptide (GLP) II

Cat. No.: IBDP-532232

Size:

Target Information

Sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Function Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .

Product Details

Product Type Peptide
Cas 89750-15-2
Molecular Weight 3766.20 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.