Cat. No.: IBDP-532232
Size:
Online InquiryTarget Information
| Sequence | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Function | Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes . |
Product Details
| Product Type | Peptide |
| Cas | 89750-15-2 |
| Molecular Weight | 3766.20 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |