Cat. No.: IBDI-438320
Product Details
| Target | Antibiotic | Bacterial |
| Molecular Weight | 4328.20 |
| Synonyms | HβD-2 |
| Sequence | Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
| Sequence Shortening | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38) |
Storage & Handling
| Shipping | Room temperature in continental US. May vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |