Cat. No.: IBDI-438321
Product Details
| Target | Antibiotic | Bacterial |
| Molecular Weight | 5155.17 |
| Synonyms | HβD-3 |
| Sequence | Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
| Sequence Shortening | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
Storage & Handling
| Shipping | Room temperature in continental US. May vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |