Cat. No.: IBDP-532306
Size:
Online InquiryTarget Information
| Synonyms | Growth Hormone Releasing Factor human |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Function | Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary. |
Product Details
| Product Type | Peptide |
| Cas | 83930-13-6 |
| Molecular Weight | 5039.65 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |