Cat. No.: IBDP-532307
Size:
Online InquiryTarget Information
| Synonyms | Growth Hormone Releasing Factor human TFA |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Function | Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 5153.67 kDa |
| Purity | 0.9602 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |