Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Interleukin-6 fragment

Cat. No.: IBDP-532338

Size:

Target Information

Sequence IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK
Function Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis.

Product Details

Product Type Peptide
Cas 145990-81-4
Molecular Weight 4023.48 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.