Cat. No.: IBDP-532338
Size:
Online InquiryTarget Information
| Sequence | IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK |
| Function | Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis. |
Product Details
| Product Type | Peptide |
| Cas | 145990-81-4 |
| Molecular Weight | 4023.48 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |