Cat. No.: IBDP-532354
Size:
Online InquiryTarget Information
| Sequence | HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 |
| Function | [K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively. VIP: VASOACTIVE Intestinal Polypeptide. |
Product Details
| Product Type | Peptide |
| Cas | 201995-58-6 |
| Molecular Weight | 3171.70 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |