Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Kaliotoxin (1-37)

Cat. No.: IBDP-532358

Size:

Target Information

Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTP (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
Function Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker.

Product Details

Product Type Peptide
Cas 150769-72-5
Molecular Weight 4018.82 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.