Cat. No.: IBDP-532406
Size:
Online InquiryTarget Information
| Sequence | [LL-37, 37 aa] |
| Function | LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4553.31 kDa |
| Purity | 0.9996 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |