Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

LL-37 acetate

Cat. No.: IBDP-532406

Size:

Target Information

Sequence [LL-37, 37 aa]
Function LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing.

Product Details

Product Type Peptide
Molecular Weight 4553.31 kDa
Purity 0.9996

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.