Cat. No.: IBDP-532572
Size:
Online InquiryTarget Information
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Function | PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1. |
Product Details
| Product Type | Peptide |
| Cas | 129405-61-4 |
| Molecular Weight | 4535.24 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |