Cat. No.: IBDP-532573
Size:
Online InquiryTarget Information
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK |
| Function | PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4649.26 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |