Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

PACAP (1-38) free acid TFA

Cat. No.: IBDP-532573

Size:

Target Information

Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK
Function PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1.

Product Details

Product Type Peptide
Molecular Weight 4649.26 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.