Cat. No.: IBDP-532583
Size:
Online InquiryTarget Information
| Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 |
| Function | Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion. |
Product Details
| Product Type | Peptide |
| Cas | 59763-91-6 |
| Molecular Weight | 4182.70 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |