Cat. No.: IBDP-532612
Size:
Online InquiryTarget Information
| Sequence | FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF |
| Function | Peptide B, bovine is an immunoregulatory peptide in bovine milk. Peptide B, bovine comes from αs1-casein B-8P (f1-13), is the major peptide produced during the ripening process with antihypertensive effects. |
Product Details
| Product Type | Peptide |
| Cas | 87713-86-8 |
| Molecular Weight | 3656.99 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |