Cat. No.: IBDP-532616
Size:
Online InquiryTarget Information
| Sequence | YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
| Function | Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system. |
Product Details
| Product Type | Peptide |
| Cas | 81858-94-8 |
| Molecular Weight | 4240.72 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |