Peptide YY (pig)

Cat. No.: IBDI-438537

Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.

Product Details

Target	Neuropeptide Y Receptor
Molecular Weight	4240.72
Sequence Shortening	YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.