Cat. No.: IBDP-532623
Size:
Online InquiryTarget Information
Synonyms | pHLIP |
Sequence | ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET |
Function | pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages. |
Product Details
Product Type | Peptide |
Cas | 2293160-09-3 |
Molecular Weight | 4052.03 kDa |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |