Cat. No.: IBDP-532623
Size:
Online InquiryTarget Information
| Synonyms | pHLIP |
| Sequence | ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET |
| Function | pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages. |
Product Details
| Product Type | Peptide |
| Cas | 2293160-09-3 |
| Molecular Weight | 4052.03 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |