Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

pH-Low Insertion Peptide

Cat. No.: IBDP-532623

Size:

Target Information

Synonyms pHLIP
Sequence ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET
Function pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages.

Product Details

Product Type Peptide
Cas 2293160-09-3
Molecular Weight 4052.03 kDa

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.