Cat. No.: IBDP-532624
Size:
Online InquiryTarget Information
| Sequence | HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 |
| Function | PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism. |
Product Details
| Product Type | Peptide |
| Cas | 87403-73-4 |
| Molecular Weight | 2985.41 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |