Cat. No.: IBDA-430226
Size:
Online InquiryTarget Information
| Target Name | PIM1/Pim‑1 |
| Synonyms | PIM1 | Pim-1 kinase 44 kDa isoform | Proviral integration site 1 | Oncogene PIM1 | PIM | Pim-1 | Pim-1 oncogene |
| Uniprot ID | P11309 |
| Immunogen | Synthetic peptide from the C-Terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK). |
Product Details
| Description | Pim-1 antibody is an unconjugated rabbit polyclonal antibody to Pim-1 (PIM1) (aa282-312) from human. |
| Host Species | Rabbit |
| Clonality | Polyclonal |
| Purity | Immunoaffinity purified |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
| Reactivity | Rabbit, Dog, Sheep, Bovine, Pig, Horse, Human |
| Specificity | Human PIM1 / Pim-1 |
| Immunogen | Synthetic peptide from the C-Terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK). |
| Application | WB |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Short term: 4 °C. Long term: -20 °C |
| Storage Buffer | Lyophilized from PBS, 2.5% BSA, 0.025% Sodium Azide. |
| Handling | Avoid freeze-thaw cycles. |