Cat. No.: IBDP-532215
Size:
Online InquiryTarget Information
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Function | Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism. |
Product Details
| Product Type | Peptide |
| Cas | 11063-17-5 |
| Molecular Weight | 4975.55 kDa |
| Purity | 0.9903 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |