Cat. No.: IBDP-532649
Size:
Online InquiryTarget Information
| Sequence | HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV |
| Function | Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus. |
Product Details
| Product Type | Peptide |
| Cas | 111366-38-2 |
| Molecular Weight | 4552.13 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |