Psalmotoxin 1

Target Information

Synonyms	PcTx1|||Psalmopoeus cambridgei toxin-1
Sequence	EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
Function	Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H+ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

Product Details

Product Type	Peptide
Molecular Weight	4689.41 kDa
Purity	≥99.0%

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.