Recombinant Cynomolgus BCMA/TNFRSF17 Protein

Target Information

Synonyms	rCynBCMA-Tall_bind domain-containing protein/BCMA, Fc|||Tumor necrosis factor receptor superfamily member 17|||B-cell maturation protein|||CD269|||Tnfrsf17|||Bcm|||Bcma
Sequence	MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
Function	B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein, Cynomolgus (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 53 amino acids (M1-A53) and is produced in HEK293 cells.

Product Details

Product Type	Protein
Species	Cynomolgus
Source	HEK 293 Cells
Tag	Fc Tag
Endotoxin Level	<1.0 Eu/µg
Molecular Weight	38-45 kDa
Purity	≥95%

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.