Cat. No.: IBDP-530054
Size:
Online InquiryTarget Information
| Synonyms | T-cell immunoreceptor with Ig and ITIM domains|||VSIG9|||VSTM3|||TIGIT|||V-set and transmembrane domain-containing protein 3|||V-set and immunoglobulin domain-containing protein 9 |
| Sequence | MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP |
Product Details
| Product Type | Protein |
| Species | Cynomolgus |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 16-30 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |