Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus TIGIT Protein

Cat. No.: IBDP-530053

Size:

Target Information

Synonyms T-cell immunoreceptor with Ig and ITIM domains|||VSIG9|||VSTM3|||TIGIT|||V-set and transmembrane domain-containing protein 3|||V-set and immunoglobulin domain-containing protein 9
Sequence MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 45-55 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.