Recombinant Human AMCase Protein

Target Information

Sequence	MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL VQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIH VMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAE KLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICT FLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAM VWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAP SGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQ NCQAGLVFDTSCDCCNWA
Sequence Similarities	Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. Contains 1 chitin-binding type-2 domain.
Amino Acids	1 to 368
Cellular Localization	Cytoplasm and Secreted. Secretion depends on EGFR activity.
Tissue Specificity	Detected in lung epithelial cells from asthma patients (at protein level). Highly expressed in stomach. Detected at lower levels in lung.
Function	Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Protein Length	Full length protein
Molecular Weight	67 kDa
Active	No
Animal free	No
Nature	Recombinant
Application	ELISA, SDS-PAGE, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.