Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Amphiregulin Protein

Cat. No.: IBDP-530554

Size:

Target Information

Synonyms rHuAmphiregulin|||AR|||AREG|||Colorectum cell-derived growth factor|||CRDGF
Sequence SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Function Amphiregulin Protein (HEK293, His) is an EGF receptor (EGFR) ligand, and essential for epithelial development in various organs.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Tag Free
Endotoxin Level <0.2 Eu/μg
Molecular Weight 15-20 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.