Cat. No.: IBDP-530803
Size:
Online InquiryTarget Information
| Synonyms | Glial cell line-derived neurotrophic factor|||ATF|||HFB1-GDNF|||HGDNF|||HSCR3 |
| Sequence | MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Function | Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. Animal-Free GDNF Protein (His), a recombinant animal-free protein, is produced in E.coil with a C-Terminal His-tag. It consists of 134 amino acids (S78-I211). |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | His |
| Endotoxin Level | <0.1 Eu/μg |
| Molecular Weight | 16.01 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |