Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Animal-Free IL-8/CXCL8 Protein

Cat. No.: IBDP-530413

Size:

Target Information

Synonyms Interleukin-8|||IL-8|||C-X-C Motif Chemokine 8|||Emoctakin|||Granulocyte Chemotactic Protein 1|||GCP-1|||Monocyte-Derived NeutrophIL Chemotactic Factor|||MDNCF|||Monocyte-Derived NeutrophIL-Activating Peptide|||MONAP|||NeutrophIL-Activating Protein 1|||NAP-1|||Protein 3-10C|||T-Cell Chemotactic Factor|||IL8|||CXCL8
Sequence MSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His
Endotoxin Level <0.1 Eu/μg
Molecular Weight 9.32 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.