Cat. No.: IBDP-531025
Size:
Online InquiryTarget Information
| Synonyms | rHuBCMA|||TNFRSF17|||CD269|||B-cell maturation protein|||BCM |
| Sequence | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Function | B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein is a recombinant protein consisting of 50 amino acids (A5-A54) and is produced in E. coli cells. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 5.4 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |